PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Phvul.001G179400.1
Common NamePHAVU_001G179400g
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Phaseolus
Family MYB
Protein Properties Length: 332aa    MW: 36735.8 Da    PI: 6.7626
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Phvul.001G179400.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding56.27.7e-181462148
                        TSSS-HHHHHHHHHHHHHTTTT.-HHHHHHHHTTTS-HHHHHHHHHHHT CS
     Myb_DNA-binding  1 rgrWTteEdellvdavkqlGgg.tWktIartmgkgRtlkqcksrwqkyl 48
                        +g+W++eEd +l+d+++q+G+g +W + ++++g++R++k+c++rw++yl
  Phvul.001G179400.1 14 KGPWSPEEDAKLKDYIEQHGTGgNWIALPQKVGLKRCGKSCRLRWLNYL 62
                        79*********************************************97 PP

2Myb_DNA-binding35.81.8e-1169111246
                         SSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
     Myb_DNA-binding   2 grWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                         g ++  Ede +  +++  G++ W+ Ia+ ++ gRt++++k++w++
  Phvul.001G179400.1  69 GQFSDAEDEVICSLFASIGSR-WSIIASQLP-GRTDNDIKNYWNT 111
                         7899*****************.*********.***********97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129415.188962IPR017930Myb domain
SuperFamilySSF466891.38E-2611109IPR009057Homeodomain-like
SMARTSM007171.6E-131364IPR001005SANT/Myb domain
PfamPF002492.3E-161462IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.4E-241569IPR009057Homeodomain-like
CDDcd001672.83E-101662No hitNo description
PROSITE profilePS5129421.52663117IPR017930Myb domain
SMARTSM007171.0E-967115IPR001005SANT/Myb domain
PfamPF002496.7E-1069111IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.603.1E-2370117IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 332 aa     Download sequence    Send to blast
MGRAPCCDKA NVKKGPWSPE EDAKLKDYIE QHGTGGNWIA LPQKVGLKRC GKSCRLRWLN  60
YLRPNIKHGQ FSDAEDEVIC SLFASIGSRW SIIASQLPGR TDNDIKNYWN TRLKKKMMAM  120
NPSPQSKPRR ITLLSILESS TPSSSPLSFR DNSNSYYHPH GSFTGVGSFS YTSSLLSGNN  180
SSASADSFFQ AQESFIDPTQ KCQFKDSSNN SMFVFGGEAA ATSCSSSDAS CNNQISQVTE  240
PEFGEASFVE QIGVADNHLY SGVENTTHKL MMFSSGSAST VSGWTDKQNG LWEQNPLDYG  300
LEEIKQLIST NNNCNNFLFD DKKTEERVTY Y*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A6e-24141177108B-MYB
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0150370.0AP015037.1 Vigna angularis var. angularis DNA, chromosome 4, almost complete sequence, cultivar: Shumari.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_007162775.10.0hypothetical protein PHAVU_001G179400g
TrEMBLV7CXD70.0V7CXD7_PHAVU; Uncharacterized protein
STRINGGLYMA19G36830.10.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF13034340
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G65790.15e-76myb domain protein 68